Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1A
LigandBDBM85079
Substrate/Competitorn/a
Ki 0.7±n/a nM
CommentsPDSP_2284
Citation Mos JVan Hest AVan Drimmelen MHerremans AHOlivier B The putative 5-HT1A receptor antagonist DU125530 blocks the discriminative stimulus of the 5-HT1A receptor agonist flesinoxan in pigeons. Eur J Pharmacol 325:145-53 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
HTR1A
Name:HTR1A
Synonyms:5-HT1A
Type:Enzyme Catalytic Domain
Mol. Mass.:45800.53
Organism:pigeon
Description:5-HT1A HTR1A pigeon::A0A1V4KRM0
Residue:413
Sequence:
MDVANNTTSPERSPEGAGGPGLAEVTLGYQLLTSLLLGTLILCAVSGNACVIAAIALERS
LQTVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDIFISLDVLCCTSSILH
LCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFLISIPPMLGWRTPEDRSDPDA
CTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFKAARFRIRKTVRKVEKKKVADTCLTLS
PSALQKKSNGEPGKGWRRTVEHKPGVCVNGAVRQGEDGAALEIIEVQRCNSSSKTHLPLP
SEACGSPPPPSFEKRNEKNTEAKRRMALSRERKTVKTLGIIMGTFILCWLPFFIVALVLP
FCDSKCYMPKWLEAVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCKFCRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85079
n/a
NameBDBM85079
Synonyms:2-[4-[4-[(7-Chloro-2,3-dihydro-1,4-benzodioxin)-5-yl]-1-piperazinyl]butyl]-1,2-benzisothiazol-3(2H)-one 1,1-dioxide | CHEMBL79261 | DU-125530 | DU125530
TypeSmall organic molecule
Emp. Form.C23H26ClN3O5S
Mol. Mass.491.988
SMILESClc1cc2OCCOc2c(c1)N1CCN(CCCCN2C(=O)c3ccccc3S2(=O)=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: