Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM82517
Substrate/Competitorn/a
Ki 794±n/a nM
CommentsPDSP_1289
Citation Mos JVan Hest AVan Drimmelen MHerremans AHOlivier B The putative 5-HT1A receptor antagonist DU125530 blocks the discriminative stimulus of the 5-HT1A receptor agonist flesinoxan in pigeons. Eur J Pharmacol 325:145-53 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
HTR1D
Name:HTR1D
Synonyms:5-HT1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41807.41
Organism:pigeon
Description:5-HT1D HTR1D pigeon::A0A1V4JDN9
Residue:375
Sequence:
MTQYNHSAELALQSSANKSLNFTEALDERTLLGLKISLSVLLSVITLATILANVFVVITI
FLTRKLHTPANYLIGSLAVTDLLVSVLVMPISIAYTVTHTWAFGQVLCDIWLSSDITCCT
ASILHLCVIALDRYWAITDALEYAKRRTAGRAALMIAVVWMISVSISVPPFFWRQVKAHE
EIAKCAVNTDQISYTIYSTCGAFYIPSVLLLILYGRIYVAARSRILKPPSLYGKRFTTAH
LITGSAGSSLCSINASLHEGHSHPGGSPIFINHVQIKLADSVLERKRISAARERKATKTL
GIILGAFIFCWLPFFVMSLVLPICQDACWFHPILLDFFTWLGYLNSLINPVIYTAFNEEF
KQAFQNLIRVKKRLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82517
n/a
NameBDBM82517
Synonyms:2-{4-[4-(2-Methoxy-phenyl)-piperazin-1-yl]-butyl}-isoindole-1,3-dione | CAS_107966 | CHEMBL126632 | CHEMBL8618 | NAN-190 | NSC_107966
TypeSmall organic molecule
Emp. Form.C23H27N3O3
Mol. Mass.393.4788
SMILESCOc1ccccc1N1CCN(CCCCN2C(=O)c3ccccc3C2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: