Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance-K receptor
LigandBDBM50000041
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_574
Citation Sarau HMGriswold DEPotts WFoley JJSchmidt DBWebb EFMartin LDBrawner MEElshourbagy NAMedhurst ADGiardina GAHay DW Nonpeptide tachykinin receptor antagonists: I. Pharmacological and pharmacokinetic characterization of SB 223412, a novel, potent and selective neurokinin-3 receptor antagonist. J Pharmacol Exp Ther 281:1303-11 (1997) [PubMed]
More Info.:Get all data from this article
 
Substance-K receptor
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2)
Type:Protein
Mol. Mass.:44455.78
Organism:Homo sapiens (Human)
Description:P21452
Residue:398
Sequence:
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000041
n/a
NameBDBM50000041
Synonyms:(+) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+/-)(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-((1R,4S)-2-phenyl-piperidin-4-yl)-amine | (2-Methoxy-benzyl)-((2S,3S)-2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2S,3S)-3-(2-Methoxy-benzyloxy)-2-phenyl-piperidine | (2S,3S)-N-(2-methoxybenzyl)-2-phenylpiperidin-3-amine | CHEMBL2114310 | CHEMBL441225 | CP 99994 | CP-99994 | Tritiated-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine
TypeSmall organic molecule
Emp. Form.C19H24N2O
Mol. Mass.296.4067
SMILESCOc1ccccc1CN[C@H]1CCCN[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: