Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50051290
Substrate/Competitorn/a
Ki 1.2±n/a nM
CommentsPDSP_1749
Citation Sarau HMGriswold DEPotts WFoley JJSchmidt DBWebb EFMartin LDBrawner MEElshourbagy NAMedhurst ADGiardina GAHay DW Nonpeptide tachykinin receptor antagonists: I. Pharmacological and pharmacokinetic characterization of SB 223412, a novel, potent and selective neurokinin-3 receptor antagonist. J Pharmacol Exp Ther 281:1303-11 (1997) [PubMed]
More Info.:Get all data from this article
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051290
n/a
NameBDBM50051290
Synonyms:CHEMBL299377 | N-(1-{3-[1-Benzoyl-3-(3,4-dichloro-phenyl)-piperidin-3-yl]-propyl}-4-phenyl-piperidin-4-yl)-N-methyl-acetamide | SR 142801 | SR 142806 | SR-142801
TypeSmall organic molecule
Emp. Form.C35H41Cl2N3O2
Mol. Mass.606.625
SMILESCN(C(C)=O)C1(CCN(CCCC2(CCCN(C2)C(=O)c2ccccc2)c2ccc(Cl)c(Cl)c2)CC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: