Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor (2b and 2c)
LigandBDBM29525
Substrate/Competitorn/a
Ki 870.96±n/a nM
CommentsPDSP_880
Citation Bonhaus DWWeinhardt KKTaylor MDeSouza AMcNeeley PMSzczepanski KFontana DJTrinh JRocha CLDawson MWFlippin LAEglen RM RS-102221: a novel high affinity and selective, 5-HT2C receptor antagonist. Neuropharmacology 36:621-9 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin receptor (2b and 2c)
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2B | 5-HT2B | 5-hydroxytryptamine (serotonin) receptor 2B [Homo sapiens] | 5-hydroxytryptamine receptor 2B | 5-hydroxytryptamine receptor 2B (5-HT2B) | 5-hydroxytryptamine receptor 2C (5HT2C) | Serotonin (5-HT3) receptor | Serotonin 2b (5-HT2b) receptor | Serotonin Receptor 2B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:54312.47
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:481
Sequence:
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29525
n/a
NameBDBM29525
Synonyms:3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808
Typeradiolabeled ligand
Emp. Form.C19H27N3O4S
Mol. Mass.393.5
SMILESCn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: