Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2A
LigandBDBM85098
Substrate/Competitorn/a
Ki 316.22±n/a nM
CommentsPDSP_1626
Citation Bonhaus DWWeinhardt KKTaylor MDeSouza AMcNeeley PMSzczepanski KFontana DJTrinh JRocha CLDawson MWFlippin LAEglen RM RS-102221: a novel high affinity and selective, 5-HT2C receptor antagonist. Neuropharmacology 36:621-9 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
ADRA2A
Name:ADRA2A
Synonyms:Alpha 2A adrenoceptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:49324.71
Organism:RABBIT
Description:Q5ZQK3
Residue:451
Sequence:
MGSLQPDAGNGSWNGSEAPGGGARASPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGQAWCEIYLALDMLFCTSS
IAHLCAISLDRHWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIERKGGGGG
GGRQRCEINDHKWYVIASCTGSFFVPCLIMILVYVRIYQIAKRRTRVPPSRRVRTPPPPP
PPPPPPPRQPGPPSAGLMAWAPERGAGSASAETEPLPTQLNGAAGEPAAAGPRETDALDL
EESSSSEHAERPPGPASRGPRQGPSEPGEARGQHPSARARDRGARGVGGRARGDTPEAPR
RLWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNS
SLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85098
n/a
NameBDBM85098
Synonyms:N-[5-[5-(2,4-Dioxo-1,3,8-triazaspiro[4.5]decan-8-yl)-1-oxopentyl]-2,4-dimethoxyphenyl]-4-(trifluoromethyl)benzenesulfonamide | RS-102221
TypeSmall organic molecule
Emp. Form.C27H31F3N4O7S
Mol. Mass.612.618
SMILES[#6]-[#8]-c1cc(-[#8]-[#6])c(cc1-[#7][S;v6](=O)(=O)c1ccc(cc1)C(F)(F)F)-[#6](=O)-[#6]-[#6]-[#6]-[#6]-[#7]-1-[#6]-[#6]C2([#6]-[#6]-1)[#7]-[#6](=O)-[#7]-[#6]2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: