| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [342-460]/[42-168] |
|---|
| Ligand | BDBM89915 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Amplified Luminescent Proximity Homogeneous Assay (ALPHA) |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 26800±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Vankayalapati, H; Yoshioka, M; Strovel, JW; Padia, JK Methods and compositions for inhibition of bromodomain-containing proteins US Patent US9695179 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [342-460]/[42-168] |
|---|
| Name: | Bromodomain-containing protein 4 [342-460]/[42-168] |
|---|
| Synonyms: | BRD4-BD1-BD2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 3 components. |
|---|
| Component 1 |
| Name: | Bromodomain-containing protein 4 [42-168] |
|---|
| Synonyms: | BRD4 | BRD4 BD1 (aa 42-168) | BRD4_HUMAN | Bromodomain-containing protein 4 Bromo Domain 1 | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15054.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O60885[42-168] |
|---|
| Residue: | 127 |
|---|
| Sequence: | STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKII
KTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKI
NELPTEE
|
|
|
|---|
| Component 2 |
| Name: | Bromodomain-containing protein 4 [342-460] |
|---|
| Synonyms: | BRD4 | BRD4-BD2 (aa 342-460) | BRD4_HUMAN | Bromodomain containing 4 (aa 342-460) | Bromodomain-containing protein 4 (BRD4)(BD2) | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13783.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | a.a. 342-460 (BRD4-BD2) |
|---|
| Residue: | 119 |
|---|
| Sequence: | PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMS
TIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
|
|
|
|---|
| BDBM89915 |
|---|
| n/a |
|---|
| Name | BDBM89915 |
|---|
| Synonyms: | (6-chloranyl-2-oxidanylidene-4-phenyl-1H-quinolin-3-yl) N,N-diethylcarbamodithioate | (6-chloro-2-oxo-4-phenyl-1H-quinolin-3-yl) N,N-diethylcarbamodithioate | Diethyl-dithiocarbamic acid 6-chloro-2-oxo-4-phenyl-1,2-dihydro-quinolin-3-yl ester | MLS000551566 | N,N-diethylcarbamodithioic acid (6-chloro-2-keto-4-phenyl-1H-quinolin-3-yl) ester | N,N-diethylcarbamodithioic acid (6-chloro-2-oxo-4-phenyl-1H-quinolin-3-yl) ester | SMR000145491 | US9695179, 122 | cid_1616439 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19ClN2OS2 |
|---|
| Mol. Mass. | 402.961 |
|---|
| SMILES | CCN(CC)C(=S)Sc1c(-c2ccccc2)c2cc(Cl)ccc2[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
