Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM85135
Substrate/Competitorn/a
Ki 2.51±n/a nM
CommentsPDSP_1622
Citation Bonhaus DWBerger JAdham NBranchek TAHsu SALoury DNLeung EWong EHClark RDEglen RM [3H]RS 57639, a high affinity, selective 5-HT4 receptor partial agonist, specifically labels guinea-pig striatal and rat cloned (5-HT4S and 5-HT4L) receptors. Neuropharmacology 36:671-9 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
HTR4
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4L | 5-HT4S | 5-hydroxytryptamine receptor 4 | Serotonin (5-HT) receptor | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:46117.31
Organism:RAT
Description:5-HT4 HTR4 RAT::Q62758
Residue:406
Sequence:
MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSN
STFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP
QTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD
TVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85135
n/a
NameBDBM85135
Synonyms:RS 57639
TypeSmall organic molecule
Emp. Form.C24H29ClN2O5
Mol. Mass.460.95
SMILESCOc1cc(N)c(Cl)cc1C(=O)OCC1CCN(CCc2ccc3OCCOc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: