Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalanin receptor 2
LigandBDBM85172
Substrate/Competitorn/a
Ki 0.7±n/a nM
CommentsPDSP_853
Citation Smith KEForray CWalker MWJones KATamm JABard JBranchek TALinemeyer DLGerald C Expression cloning of a rat hypothalamic galanin receptor coupled to phosphoinositide turnover. J Biol Chem 272:24612-6 (1997) [PubMed]
More Info.:Get all data from this article
 
Galanin receptor 2
Name:Galanin receptor 2
Synonyms:GALR2 | Galanin R2 | Galanin receptor type 2
Type:Enzyme Catalytic Domain
Mol. Mass.:40697.04
Organism:RAT
Description:Galanin R2 GALR2 RAT::O08726
Residue:372
Sequence:
MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDLCTFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIII
VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPN
CTASSRTLDPAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85172
n/a
NameBDBM85172
Synonyms:CAS_112747-70-3 | Galanin (1-15)
TypeSmall organic molecule
Emp. Form.C72H105N19O20
Mol. Mass.1556.7194
SMILESCC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: