| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM82213 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 21±n/a nM |
|---|
| Comments | PDSP_1458 |
|---|
| Citation |  Kiriyama, M; Ushikubi, F; Kobayashi, T; Hirata, M; Sugimoto, Y; Narumiya, S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol122:217-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | Gsts | HPGDS_MOUSE | Hematopoietic prostaglandin D synthase | Hpgds | PTGDR | Pgds | Prostaglandin D | Ptgds2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23227.26 |
|---|
| Organism: | MOUSE |
|---|
| Description: | Prostaglandin D PTGDR MOUSE::Q9JHF7 |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLT
IHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELL
THQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNK
VQAIPAISAWILKRPQTKL
|
|
|
|---|
| BDBM82213 |
|---|
| n/a |
|---|
| Name | BDBM82213 |
|---|
| Synonyms: | CAS_41598-07-6 | NSC_114678 | PGD2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H30O4 |
|---|
| Mol. Mass. | 334.4498 |
|---|
| SMILES | CCCCCC(O)CC=C1C(CC=CCCCC(O)=O)C=CC1=O |w:8.7,12.11,c:20| |
|---|
| Structure | 
|
|---|
Search and Browse
