Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP3 Receptor
LigandBDBM85189
Substrate/Competitorn/a
Ki 1.5±n/a nM
CommentsPDSP_1460
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Prostanoid EP3 Receptor
Name:Prostanoid EP3 receptor
Synonyms:PGE receptor, EP3 isoform alpha | PTGER3 | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3
Type:G-protein coupled receptor
Mol. Mass.:40092.50
Organism:Mus musculus (Mouse)
Description:n/a
Residue:365
Sequence:
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85189
n/a
NameBDBM85189
Synonyms:PGE1,11-DEOXY
TypeSmall organic molecule
Emp. Form.C20H34O4
Mol. Mass.338.4816
SMILESCCCCCC(O)C=CC1CCC(=O)C1CCCCCCC(O)=O |w:7.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: