Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThromboxane Alpha
LigandBDBM50283049
Substrate/Competitorn/a
Ki 12±n/a nM
CommentsPDSP_887
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Thromboxane Alpha
Name:Thromboxane Alpha
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:60395.39
Organism:MOUSE
Description:Thromboxane Alpha 0 MOUSE::P36423
Residue:533
Sequence:
MEVLGLLKFEVSGTIVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNLMFFR
QGFWESQLELRERYGPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPKMV
ADSVLLLRDRRWEEVRGALMSSFSPEKLDEMTPLISQACELLVAHLKRYAASRDAFNIQR
CYCCYTIDVVASVAFGTQVDSQNSPEDPFVQHCRRASTFCIPRPLLVLILSFPSIMVPLA
RILPNKNRDELNGFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMV
PESLSSSECTKEPPQRCHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATH
PDCQERLLKEVDLFMGKHPAPEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEV
LGQRIPAGTVLEIAVGALHHDPEHWPNPETFDPERFTAEARLQRRPFTYLPFGAGPRSCL
GVRLGLLVVKLTILQVLHKFRFEASPETQVPLQLESKSALGPKNGVYIKIVSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283049
n/a
NameBDBM50283049
Synonyms:(Z)-7-[(1R,2R,3S,5S)-5-(Biphenyl-4-ylmethoxy)-3-hydroxy-2-piperidin-1-yl-cyclopentyl]-hept-4-enoic acid | CHEMBL65030 | GR 32191 | GR-32191
TypeSmall organic molecule
Emp. Form.C30H39NO4
Mol. Mass.477.635
SMILESO[C@H]1C[C@H](OCc2ccc(cc2)-c2ccccc2)[C@H](CC\C=C/CCC(O)=O)[C@H]1N1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: