Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM85020
Substrate/Competitorn/a
Ki 0.19±n/a nM
CommentsPDSP_881
Citation Van den Wyngaert IGommeren WVerhasselt PJurzak MLeysen JLuyten WBender E Cloning and expression of a human serotonin 5-HT4 receptor cDNA. J Neurochem 69:1810-9 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
HTR4
Name:Serotonin 4 (5-HT4) receptor
Synonyms:5-HT4 | 5-hydroxytryptamine receptor 4 | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43735.29
Organism:GUINEA PIG
Description:5-HT4 HTR4 GUINEA PIG::O70528
Residue:388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
TVECGGQWESQCHPAASSPLVAAQPIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85020
n/a
NameBDBM85020
Synonyms:5-Fluoro-2-methoxy-1H-indole-3-carboxylic acid [1-[2-[(methylsulfonyl)amino]ethyl]piperidin-4-yl]methyl ester | GR 125487 | GR-125487
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure