Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50004656
Substrate/Competitorn/a
Ki 1820±n/a nM
CommentsPDSP_467
Citation Kovacs IYamamura HIWaite SLVarga EVRoeske WR Pharmacological comparison of the cloned human and rat M2 muscarinic receptor genes expressed in the murine fibroblast (B82) cell line. J Pharmacol Exp Ther 284:500-7 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004656
n/a
NameBDBM50004656
Synonyms:(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | (2-Carbamoyloxyethyl)trimethylammonium chloride | (2-Hydroxyethyl)trimethyl ammonium chloride carbamate | (2-Hydroxyethyl)trimethylammonium chloride carbamate | (carbachol)(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminium chloride | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminum chloride | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium chloride | CARBACHOL | CARBASTAT | CHEMBL14 | Carbachol chloride | Carbamylcholine | Choline carbamate chloride | Choline chloride, carbamate | Choline chlorine carbamate | Karbachol | Karbamoylcholin chlorid | MIOSTAT
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILESC[N+](C)(C)CCOC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: