Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50071173
Substrate/Competitorn/a
Ki 14±n/a nM
CommentsPDSP_933
Citation Kovacs IYamamura HIWaite SLVarga EVRoeske WR Pharmacological comparison of the cloned human and rat M2 muscarinic receptor genes expressed in the murine fibroblast (B82) cell line. J Pharmacol Exp Ther 284:500-7 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071173
n/a
NameBDBM50071173
Synonyms:(3R,4R,4aS,8aR)-4-[(E)-2-((2S,6S)-1,6-Dimethyl-piperidin-2-yl)-vinyl]-3-methyl-decahydro-naphtho[2,3-c]furan-1-one | CHEMBL59421 | HIMBACINE
TypeSmall organic molecule
Emp. Form.C22H35NO2
Mol. Mass.345.5188
SMILESC[C@H]1OC(=O)C2C[C@H]3CCCC[C@@H]3[C@@H](\C=C\[C@@H]3CCC[C@H](C)N3C)C12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: