Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 4 (5-HT4)
LigandBDBM21280
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1751
Citation Rinaldi-Carmona MBarth FMillan JDerocq JMCasellas PCongy COustric DSarran MBouaboula MCalandra BPortier MShire DBrelière JCLe Fur GL SR 144528, the first potent and selective antagonist of the CB2 cannabinoid receptor. J Pharmacol Exp Ther 284:644-50 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 4 (5-HT4)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4
Type:Enzyme
Mol. Mass.:43767.54
Organism:Homo sapiens (Human)
Description:Q13639
Residue:388
Sequence:
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21280
n/a
NameBDBM21280
Synonyms:5-(4-chloro-3-methylphenyl)-1-[(4-methylphenyl)methyl]-N-[(1S)-1,3,3-trimethylbicyclo[2.2.1]heptan-2-yl]-1H-pyrazole-3-carboxamide | N-(1,3,3-trimethylbicyclo(2.2.1)heptan-2-yl)-5-(4-chloro-3-methylphenyl)-1-(4-methylbenzyl)pyrazole-3-carboxamide | SR 144528 | SR-144528 | SR144528
TypeSmall organic molecule
Emp. Form.C29H34ClN3O
Mol. Mass.476.053
SMILESCc1ccc(Cn2nc(cc2-c2ccc(Cl)c(C)c2)C(=O)NC2[C@@]3(C)CCC(C3)C2(C)C)cc1 |r,TLB:21:22:28:26.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: