new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C delta type
LigandBDBM3149
Substrate/CompetitorHistone type HL
Meas. Tech.PKC assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 32±n/a nM
Citation Crane HMMenaldino DSJagdmann GEDarges JWBuben JA Increasing the cellular PKC inhibitory activity of balanol: a study of ester analogs. Bioorg Med Chem Lett 5:2133-8 (1995)    Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Protein kinase C delta type
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC delta | Protein Kinase C- delta | nPKC-delta
Type:Enzyme
Mol. Mass.:77516.79
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:676
Sequence:
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3149
Histone type HL
Name:Histone type HL
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:unfractionated histone (Worthington) 30 uM [gamma-32P]ATP as co-substrate.
Residue:3
Sequence:
n/a