Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2A
LigandBDBM35234
Substrate/Competitorn/a
Ki 1412.54±n/a nM
CommentsPDSP_1348
Citation Jasper JRLesnick JDChang LKYamanishi SSChang TKHsu SADaunt DABonhaus DWEglen RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol 55:1035-43 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
ADRA2A
Name:ADRA2A
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48888.08
Organism:MOUSE
Description:adrenergic Alpha2A ADRA2A MOUSE::Q01338
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSE
HAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35234
n/a
NameBDBM35234
Synonyms:DL-[7-3H]norepinephrine | NOREPINEPHRINE | Noradrenaline,(+) | [3H]NE
Typeradiolabeled ligand
Emp. Form.C8H11NO3
Mol. Mass.169.1778
SMILESNCC(O)c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: