Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2A
LigandBDBM50019492
Substrate/Competitorn/a
Ki 0.62±n/a nM
CommentsPDSP_1648
Citation Jasper JRLesnick JDChang LKYamanishi SSChang TKHsu SADaunt DABonhaus DWEglen RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol 55:1035-43 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
ADRA2A
Name:ADRA2A
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48888.08
Organism:MOUSE
Description:adrenergic Alpha2A ADRA2A MOUSE::Q01338
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSE
HAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019492
n/a
NameBDBM50019492
Synonyms:(+)2-(2-Methoxy-2,3-dihydro-benzo[1,4]dioxin-2-yl)-4,5-dihydro-1H-imidazole | (-)2-(2-Methoxy-2,3-dihydro-benzo[1,4]dioxin-2-yl)-4,5-dihydro-1H-imidazole | 2-(2,3-dihydro-2-methoxy-1,4-benzodioxin-2-yl)-4,5-dihydro-1H-imidazole | 2-(2-Methoxy-2,3-dihydro-benzo[1,4]dioxin-2-yl)-4,5-dihydro-1H-imidazole | 2-(2-methoxy-2,3-dihydrobenzo[b][1,4]dioxin-2-yl)-4,5-dihydro-1H-imidazole | 2-ethoxy-idazoxan | CHEMBL10332 | RX-821002 | RX821002
TypeSmall organic molecule
Emp. Form.C12H14N2O3
Mol. Mass.234.2512
SMILESCOC1(COc2ccccc2O1)C1=NCCN1 |t:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: