Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM81811
Substrate/Competitorn/a
Ki 0.07±n/a nM
CommentsPDSP_5986
Citation Jasper JRLesnick JDChang LKYamanishi SSChang TKHsu SADaunt DABonhaus DWEglen RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol 55:1035-43 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81811
n/a
NameBDBM81811
Synonyms:CAS_123679 | L-657,743 | MK-912 | NSC_123679
TypeSmall organic molecule
Emp. Form.C20H25N3O2
Mol. Mass.339.4314
SMILESCN1CCC2(CCN3CCc4c(oc5ccccc45)C3C2)N(C)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: