Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM50013515
Substrate/Competitorn/a
Ki 0.55±n/a nM
CommentsPDSP_1590
Citation Jasper JRLesnick JDChang LKYamanishi SSChang TKHsu SADaunt DABonhaus DWEglen RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol 55:1035-43 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013515
n/a
NameBDBM50013515
Synonyms:(+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester
TypeSmall organic molecule
Emp. Form.C21H26N2O3
Mol. Mass.354.4427
SMILESCOC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: