| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor type 1A |
|---|
| Ligand | BDBM50043289 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.74±n/a nM |
|---|
| Comments | PDSP_1195 |
|---|
| Citation |  Beresford, IJ; Browning, C; Starkey, SJ; Brown, J; Foord, SM; Coughlan, J; North, PC; Dubocovich, ML; Hagan, RM GR196429: a nonindolic agonist at high-affinity melatonin receptors. J Pharmacol Exp Ther285:1239-45 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Melatonin receptor type 1A |
|---|
| Name: | Melatonin receptor type 1A |
|---|
| Synonyms: | MTNR1A | MTR1A_PIG | Melatonin | Melatonin receptor type 1A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17908.30 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | Melatonin 0 GUINEA PIG::O02781 |
|---|
| Residue: | 154 |
|---|
| Sequence: | YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS
AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV
LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA
|
|
|
|---|
| BDBM50043289 |
|---|
| n/a |
|---|
| Name | BDBM50043289 |
|---|
| Synonyms: | CHEMBL34730 | N-[2-(6-Chloro-5-methoxy-1H-indol-3-yl)-ethyl]-acetamide | N-[2-(6-Chloro-5-methoxy-1H-indol-3-yl)-ethyl]-acetamide(6-Chloromelatonin) | melatonin, 6-Chloro |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15ClN2O2 |
|---|
| Mol. Mass. | 266.723 |
|---|
| SMILES | COc1cc2c(CCNC(C)=O)c[nH]c2cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
