Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM85064
Substrate/Competitorn/a
Ki 0.16±n/a nM
CommentsPDSP_886
Citation Beresford IJBrowning CStarkey SJBrown JFoord SMCoughlan JNorth PCDubocovich MLHagan RM GR196429: a nonindolic agonist at high-affinity melatonin receptors. J Pharmacol Exp Ther 285:1239-45 (1998) [PubMed]
More Info.:Get all data from this article
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85064
n/a
NameBDBM85064
Synonyms:CAS_5311134 | GR 196429 | NSC_5311134
TypeSmall organic molecule
Emp. Form.C14H18N2O2
Mol. Mass.246.3049
SMILESCC(=O)NCCN1CCc2ccc3OCCc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: