Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM85236
Substrate/Competitorn/a
Ki 0.22±n/a nM
CommentsPDSP_1191
Citation Sugden DPickering HTeh MTGarratt PJ Melatonin receptor pharmacology: toward subtype specificity. Biol Cell 89:531-7 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85236
n/a
NameBDBM85236
Synonyms:Melatonin,2-Chloro
TypeSmall organic molecule
Emp. Form.C13H15ClN2O2
Mol. Mass.266.723
SMILESCOc1ccc2[nH]c(Cl)c(CCNC(C)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: