Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin 1C
LigandBDBM85240
Substrate/Competitorn/a
Ki 57.4±n/a nM
CommentsPDSP_177
Citation Sugden DPickering HTeh MTGarratt PJ Melatonin receptor pharmacology: toward subtype specificity. Biol Cell 89:531-7 (1997) [PubMed]
More Info.:Get all data from this article
 
Melatonin 1C
Name:Melatonin 1C
Synonyms:Melatonin receptor 1C | Melatonin receptor type 1C
Type:Enzyme Catalytic Domain
Mol. Mass.:47442.40
Organism:Xenopus
Description:Melatonin 1C 0 Xenopus::P49219
Residue:420
Sequence:
MMEVNSTCLDCRTPGTIRTEQDAQDSASQGLTSALAVVLIFTIVVDVLGNILVILSVLRN
KKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSV
FNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTIIAIVPNFFVGSLQYDPRIF
SCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHRVRQDFKQKLTQTDLR
NFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIY
GVLNQNFRKEYKRILMSLLTPRLLFLDTSRGGTEGLKSKPSPAVTNNNQADMLGEARSLW
LSRRNGAKMVIIIRPRKAQIAIIHQIFWPQSSWATCRQDTKITGEEDGCRELCKDGISQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85240
n/a
NameBDBM85240
Synonyms:5-MeOT-N-pentanyl
TypeSmall organic molecule
Emp. Form.C19H27N3O2
Mol. Mass.329.4366
SMILESCCCCC(=O)NCCc1ccc2[nH]cc(CCNC(C)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: