Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin 1C
LigandBDBM9019
Substrate/Competitorn/a
Ki 1.87±n/a nM
CommentsPDSP_1189
Citation Sugden DPickering HTeh MTGarratt PJ Melatonin receptor pharmacology: toward subtype specificity. Biol Cell 89:531-7 (1997) [PubMed]
More Info.:Get all data from this article
 
Melatonin 1C
Name:Melatonin 1C
Synonyms:Melatonin receptor 1C | Melatonin receptor type 1C
Type:Enzyme Catalytic Domain
Mol. Mass.:47442.40
Organism:Xenopus
Description:Melatonin 1C 0 Xenopus::P49219
Residue:420
Sequence:
MMEVNSTCLDCRTPGTIRTEQDAQDSASQGLTSALAVVLIFTIVVDVLGNILVILSVLRN
KKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSV
FNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTIIAIVPNFFVGSLQYDPRIF
SCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHRVRQDFKQKLTQTDLR
NFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIY
GVLNQNFRKEYKRILMSLLTPRLLFLDTSRGGTEGLKSKPSPAVTNNNQADMLGEARSLW
LSRRNGAKMVIIIRPRKAQIAIIHQIFWPQSSWATCRQDTKITGEEDGCRELCKDGISQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9019
n/a
NameBDBM9019
Synonyms:CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide
TypeSmall organic molecule
Emp. Form.C13H16N2O2
Mol. Mass.232.2783
SMILESCOc1ccc2[nH]cc(CCNC(C)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: