Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-1 (COX-1)
LigandBDBM50002861
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_4485
Citation Cryer BFeldman M Cyclooxygenase-1 and cyclooxygenase-2 selectivity of widely used nonsteroidal anti-inflammatory drugs. Am J Med 104:413-21 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Cyclooxygenase-1 (COX-1)
Name:Cyclooxygenase
Synonyms:COX-1 | Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme
Mol. Mass.:68692.62
Organism:Homo sapiens (Human)
Description:P23219
Residue:599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002861
n/a
NameBDBM50002861
Synonyms:3-(4,5-Diphenyl-oxazol-2-yl)-propionic acid | CHEMBL1071 | Daypro | OXAPROZIN | WY-21743 | oxaprosin
TypeSmall organic molecule
Emp. Form.C18H15NO3
Mol. Mass.293.3166
SMILESOC(=O)CCc1nc(c(o1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: