Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 4
LigandBDBM85248
Substrate/Competitorn/a
Ki 1.78±n/a nM
CommentsPDSP_588
Citation Siehler SSeuwen KHoyer D [125I]Tyr10-cortistatin14 labels all five somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol 357:483-9 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 4
Name:Somatostatin receptor type 4
Synonyms:SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SST4R | Somatostatin receptor type 4 (SSTR4)
Type:Enzyme
Mol. Mass.:42015.38
Organism:Homo sapiens (Human)
Description:P31391
Residue:388
Sequence:
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85248
n/a
NameBDBM85248
Synonyms:CST14 | Cortistatin(1-14)
TypeSmall organic molecule
Emp. Form.C81H115N19O19S2
Mol. Mass.1723.026
SMILESC[C@@H](O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: