new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamine synthetase
LigandBDBM85289
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7±0
Ki 140±30 nM
Citation Johnson RCBoettcher BRCherpeck REDolson MG Design and Synthesis of Potent Inhibitors of Glutamine Synthetase Bioorg Chem 18:154-9 (1990)  
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glutamine synthetase
Name:Glutamine synthetase
Synonyms:Glutamate decarboxylase
Type:Protein
Mol. Mass.:42066.51
Organism:Homo sapiens (Human)
Description:P15104
Residue:373
Sequence:
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85289
n/a
NameBDBM85289
Synonyms:Phosphinothricin analog, 2 (D,L mixture)
TypeSmall organic molecule
Emp. Form.C6H13NO4P
Mol. Mass.194.146
SMILESCC(CC([NH3+])C([O-])=O)P(C)([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: