Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT3A Serotonin Receptor
LigandBDBM48320
Substrate/Competitorn/a
Ki 353±n/a nM
CommentsPDSP_1233
Citation Toll LBerzetei-Gurske IPPolgar WEBrandt SRAdapa IDRodriguez LSchwartz RWHaggart DO'Brien AWhite AKennedy JMCraymer KFarrington LAuh JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr 178:440-66 (1998) [PubMed]
More Info.:Get all data from this article
 
5-HT3A Serotonin Receptor
Name:5-HT3A Serotonin Receptor
Synonyms:5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor
Type:n/a
Mol. Mass.:56056.00
Organism:Mus musculus (house mouse)
Description:5HT3A
Residue:487
Sequence:
MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM48320
n/a
NameBDBM48320
Synonyms:4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | 4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxybenzamide;hydrochloride | 4-azanyl-5-chloranyl-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | METOCLOPRAMIDE | METOCLOPRAMIDE HYDROCHLORIDE | MLS000069667 | Metochloropramide | SMR000058471 | US9132134, Metoclopramide | cid_23659
TypeSmall organic molecule
Emp. Form.C14H22ClN3O2
Mol. Mass.299.796
SMILESCCN(CC)CCNC(=O)c1cc(Cl)c(N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: