Reaction Details |
| Report a problem with these data |
Target | D(3) dopamine receptor |
---|
Ligand | BDBM48320 |
---|
Substrate/Competitor | n/a |
---|
Ki | 16±n/a nM |
---|
Comments | PDSP_1233 |
---|
Citation | Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
D(3) dopamine receptor |
---|
Name: | D(3) dopamine receptor |
Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
Type: | n/a |
Mol. Mass.: | 44243.43 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 400 |
Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
BDBM48320 |
---|
n/a |
---|
Name | BDBM48320 |
Synonyms: | 4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | 4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxybenzamide;hydrochloride | 4-azanyl-5-chloranyl-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | METOCLOPRAMIDE | METOCLOPRAMIDE HYDROCHLORIDE | MLS000069667 | Metochloropramide | SMR000058471 | US11147820, Compound Metoclopramide | US11717500, Compound Metoclopramide | US9132134, Metoclopramide | cid_23659 |
Type | Small organic molecule |
Emp. Form. | C14H22ClN3O2 |
Mol. Mass. | 299.796 |
SMILES | CCN(CC)CCNC(=O)c1cc(Cl)c(N)cc1OC |
Structure |
|