| Reaction Details |
|---|
 | Report a problem with these data |
| Target | OPRD1 |
|---|
| Ligand | BDBM50013388 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.3±n/a nM |
|---|
| Comments | PDSP_414 |
|---|
| Citation |  Toll L; Berzetei-Gurske IP; Polgar WE; Brandt SR; Adapa ID; Rodriguez L; Schwartz RW; Haggart D; O'Brien A; White A; Kennedy JM; Craymer K; Farrington L; Auh JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr 178:440-66 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| OPRD1 |
|---|
| Name: | Delta opioid receptor |
|---|
| Synonyms: | Delta opioid receptor | Delta-type opioid receptor | OPIATE Delta |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25736.90 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | OPIATE Delta OPRD1 GUINEA PIG::P79291 |
|---|
| Residue: | 228 |
|---|
| Sequence: | GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM
FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR
DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK
DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
|
|
|
|---|
| BDBM50013388 |
|---|
| n/a |
|---|
| Name | BDBM50013388 |
|---|
| Synonyms: | 6-Ethyl-3-(1-hydroxy-cyclopropylmethyl)-11,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | BREMAZOCINE(-) | Bremazocine | CHEMBL350384 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H29NO2 |
|---|
| Mol. Mass. | 315.4498 |
|---|
| SMILES | CCC12CCN(CC3(O)CC3)C(Cc3ccc(O)cc13)C2(C)C |TLB:6:5:20:19.13.12| |
|---|
| Structure | 
|
|---|
Search and Browse
