| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50001022 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.6±n/a nM |
|---|
| Comments | PDSP_601 |
|---|
| Citation |  Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Delta opioid receptor | Delta-type opioid receptor | OPIATE Delta | OPRD1 | OPRD_PIG |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25736.90 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | OPIATE Delta OPRD1 GUINEA PIG::P79291 |
|---|
| Residue: | 228 |
|---|
| Sequence: | GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM
FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR
DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK
DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
|
|
|
|---|
| BDBM50001022 |
|---|
| n/a |
|---|
| Name | BDBM50001022 |
|---|
| Synonyms: | (2S,6S,11S)-3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | (SSS)-12-Cyclopropylmethyl-13-methyl-12-aza-tricyclo[9.1.1.0*3,8*]trideca-3(8),4,6-trien-6-ol(cyclazocine) | 3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL293349 | CYCLAZOCINE (-) | Cyclazocine | Cyclazocine (+) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H25NO |
|---|
| Mol. Mass. | 271.3972 |
|---|
| SMILES | C[C@@H]1[C@@H]2Cc3ccc(O)cc3[C@@]1(C)CCN2CC1CC1 |TLB:16:15:1:10.4.3| |
|---|
| Structure | 
|
|---|
Search and Browse
