Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50001022 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.1±n/a nM |
---|
Comments | PDSP_601 |
---|
Citation | Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50001022 |
---|
n/a |
---|
Name | BDBM50001022 |
Synonyms: | (2S,6S,11S)-3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | (SSS)-12-Cyclopropylmethyl-13-methyl-12-aza-tricyclo[9.1.1.0*3,8*]trideca-3(8),4,6-trien-6-ol(cyclazocine) | 3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL293349 | CYCLAZOCINE (-) | Cyclazocine | Cyclazocine (+) |
Type | Small organic molecule |
Emp. Form. | C18H25NO |
Mol. Mass. | 271.3972 |
SMILES | C[C@@H]1[C@@H]2Cc3ccc(O)cc3[C@@]1(C)CCN2CC1CC1 |TLB:16:15:1:10.4.3| |
Structure |
|