Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM82427
Substrate/Competitorn/a
Ki 0.3±n/a nM
CommentsPDSP_1072
Citation Toll LBerzetei-Gurske IPPolgar WEBrandt SRAdapa IDRodriguez LSchwartz RWHaggart DO'Brien AWhite AKennedy JMCraymer KFarrington LAuh JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr 178:440-66 (1998) [PubMed]
More Info.:Get all data from this article
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82427
n/a
NameBDBM82427
Synonyms:CAS_5985-38-6 | LEVORPHANOL-tartarate
TypeSmall organic molecule
Emp. Form.C17H23NO
Mol. Mass.257.3706
SMILESCN1CC[C@]23CCCC[C@H]2[C@H]1Cc1ccc(O)cc31 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: