| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM82507 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.4±n/a nM |
|---|
| Comments | PDSP_1 |
|---|
| Citation |  Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM82507 |
|---|
| n/a |
|---|
| Name | BDBM82507 |
|---|
| Synonyms: | (+/-)-Methadone | CAS_5967-73-7 | METHADONE | Methadone-HCL,(-) | NSC_22266 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO |
|---|
| Mol. Mass. | 309.4452 |
|---|
| SMILES | CCC(=O)C(CC(C)N(C)C)(c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
