Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGER3
LigandBDBM85174
Substrate/Competitorn/a
Ki 11±n/a nM
CommentsPDSP_888
Citation Sharif NAXu SXWilliams GWCrider JYGriffin BWDavis TL Pharmacology of [3H]prostaglandin E1/[3H]prostaglandin E2 and [3H]prostaglandin F2alpha binding to EP3 and FP prostaglandin receptor binding sites in bovine corpus luteum: characterization and correlation with functional data. J Pharmacol Exp Ther 286:1094-102 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
PTGER3
Name:PTGER3
Synonyms:Prostaglandin E3
Type:Enzyme Catalytic Domain
Mol. Mass.:46379.75
Organism:BOVINE
Description:Prostaglandin E3 PTGER3 BOVINE::P34979
Residue:417
Sequence:
MKATRDHASAPFCTRFNHSDPGIWAAERAVEAPNNLTLPPEPSEDCGSVSVAFSMTMMIT
GFVGNALAITLVSKSYRRREGKRKKSFLLCIGWLALTDMVGQLLTSPVVIVLYLSHQRWE
QLDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALATRAPHWYSSHMKTSVTRAVLLGV
WLAVLAFALLPVLGVGQYTIQWPGTWCFISTGPGGNGTNSRQNWGNVFFASAFAILGLSA
LVVTFACNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIM
MLKMIFNHTSVEHCKTYTENQDECNFFLIAVRLASLNQILDPWVYLLLRKILLQKFCQLL
KGHSYGLDTEGGTENKDKEMKENLYISNLSRFFILLGHFTEARRGRGHIYLHTLEHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85174
n/a
NameBDBM85174
Synonyms:CAS_5311224 | GR 63799X | NSC_5311224
TypeSmall organic molecule
Emp. Form.C34H37NO8
Mol. Mass.587.6595
SMILESOC(COC1C(O)CC(=O)C1CCC=CCCC(=O)Oc1ccc(NC(=O)c2ccccc2)cc1)COc1ccccc1 |w:13.13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: