Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGER3
LigandBDBM50101828
Substrate/Competitorn/a
Ki 2±n/a nM
CommentsPDSP_1459
Citation Sharif NAXu SXWilliams GWCrider JYGriffin BWDavis TL Pharmacology of [3H]prostaglandin E1/[3H]prostaglandin E2 and [3H]prostaglandin F2alpha binding to EP3 and FP prostaglandin receptor binding sites in bovine corpus luteum: characterization and correlation with functional data. J Pharmacol Exp Ther 286:1094-102 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
PTGER3
Name:PTGER3
Synonyms:Prostaglandin E3
Type:Enzyme Catalytic Domain
Mol. Mass.:46379.75
Organism:BOVINE
Description:Prostaglandin E3 PTGER3 BOVINE::P34979
Residue:417
Sequence:
MKATRDHASAPFCTRFNHSDPGIWAAERAVEAPNNLTLPPEPSEDCGSVSVAFSMTMMIT
GFVGNALAITLVSKSYRRREGKRKKSFLLCIGWLALTDMVGQLLTSPVVIVLYLSHQRWE
QLDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALATRAPHWYSSHMKTSVTRAVLLGV
WLAVLAFALLPVLGVGQYTIQWPGTWCFISTGPGGNGTNSRQNWGNVFFASAFAILGLSA
LVVTFACNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIM
MLKMIFNHTSVEHCKTYTENQDECNFFLIAVRLASLNQILDPWVYLLLRKILLQKFCQLL
KGHSYGLDTEGGTENKDKEMKENLYISNLSRFFILLGHFTEARRGRGHIYLHTLEHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101828
n/a
NameBDBM50101828
Synonyms:7-[(1R,2R,3R)-3-Hydroxy-2-((E)-(R)-3-hydroxy-oct-1-enyl)-5-oxo-cyclopentyl]-heptanoic acid | CHEMBL62570 | PGE1 | US9180116, PGE1
TypeSmall organic molecule
Emp. Form.C20H34O5
Mol. Mass.354.481
SMILESCCCCC[C@@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: