Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM85200
Substrate/Competitorn/a
Ki 0.34±n/a nM
CommentsPDSP_3179
Citation Smith KEWalker MWArtymyshyn RBard JBorowsky BTamm JAYao WJVaysse PJBranchek TAGerald CJones KA Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels. J Biol Chem 273:23321-6 (1998) [PubMed]
More Info.:Get all data from this article
 
GALR1
Name:GALR1
Synonyms:Galanin R1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38883.91
Organism:RAT
Description:Galanin R1 GALR1 RAT::Q62805
Residue:346
Sequence:
MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARS
KPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLV
SIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDS
NQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASK
KKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPII
YAFLSENFRKAYKQVFKCRVCNESPHGDAKEKNRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85200
n/a
NameBDBM85200
Synonyms:Galanin (1-19), rat | Galanin rat
TypeSmall organic molecule
Emp. Form.C92H135N27O26
Mol. Mass.2035.2216
SMILESCCC(C)C(NC(=O)C(C)NC(=O)C(Cc1cnc[nH]1)NC(=O)C1CCCN1C(=O)CNC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)CNC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)CN)C(C)O)C(=O)NC(CC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(Cc1cnc[nH]1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: