| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galanin receptor type 1 |
|---|
| Ligand | BDBM85073 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.65±n/a nM |
|---|
| Comments | PDSP_3166 |
|---|
| Citation |  Smith, KE; Walker, MW; Artymyshyn, R; Bard, J; Borowsky, B; Tamm, JA; Yao, WJ; Vaysse, PJ; Branchek, TA; Gerald, C; Jones, KA Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels. J Biol Chem273:23321-6 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Galanin receptor type 1 |
|---|
| Name: | Galanin receptor type 1 |
|---|
| Synonyms: | GALR1_RAT | Galanin R1 | Galanin receptor type 1 | Galnr | Galnr1 | Galr1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38883.91 |
|---|
| Organism: | RAT |
|---|
| Description: | Galanin R1 GALR1 RAT::Q62805 |
|---|
| Residue: | 346 |
|---|
| Sequence: | MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARS
KPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLV
SIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDS
NQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASK
KKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPII
YAFLSENFRKAYKQVFKCRVCNESPHGDAKEKNRIDTPPSTNCTHV
|
|
|
|---|
| BDBM85073 |
|---|
| n/a |
|---|
| Name | BDBM85073 |
|---|
| Synonyms: | CAS_3043476 | Galantide (M15) | NSC_3043476 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N2O3 |
|---|
| Mol. Mass. | 382.4959 |
|---|
| SMILES | COc1ccccc1N(CCOc1ccc(C)cc1)C(=O)CN1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
