Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM85073
Substrate/Competitorn/a
Ki 0.65±n/a nM
CommentsPDSP_3166
Citation Smith KEWalker MWArtymyshyn RBard JBorowsky BTamm JAYao WJVaysse PJBranchek TAGerald CJones KA Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels. J Biol Chem 273:23321-6 (1998) [PubMed]
More Info.:Get all data from this article
 
GALR1
Name:GALR1
Synonyms:Galanin R1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38883.91
Organism:RAT
Description:Galanin R1 GALR1 RAT::Q62805
Residue:346
Sequence:
MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARS
KPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLV
SIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDS
NQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASK
KKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPII
YAFLSENFRKAYKQVFKCRVCNESPHGDAKEKNRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85073
n/a
NameBDBM85073
Synonyms:CAS_3043476 | Galantide (M15) | NSC_3043476
TypeSmall organic molecule
Emp. Form.C23H30N2O3
Mol. Mass.382.4959
SMILESCOc1ccccc1N(CCOc1ccc(C)cc1)C(=O)CN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: