Reaction Details |
| Report a problem with these data |
Target | Somatostatin receptor type 1 |
---|
Ligand | BDBM50059090 |
---|
Substrate/Competitor | n/a |
---|
Ki | 230±n/a nM |
---|
Comments | PDSP_1405 |
---|
Citation | Yang, L; Berk, SC; Rohrer, SP; Mosley, RT; Guo, L; Underwood, DJ; Arison, BH; Birzin, ET; Hayes, EC; Mitra, SW; Parmar, RM; Cheng, K; Wu, TJ; Butler, BS; Foor, F; Pasternak, A; Pan, Y; Silva, M; Freidinger, RM; Smith, RG; Chapman, K; Schaeffer, JM; Patchett, AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A95:10836-41 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Somatostatin receptor type 1 |
---|
Name: | Somatostatin receptor type 1 |
Synonyms: | SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSR1_HUMAN | SSTR1 | Somatostatin receptor type 1 (SSTR1) |
Type: | Enzyme |
Mol. Mass.: | 42692.81 |
Organism: | Homo sapiens (Human) |
Description: | P30872 |
Residue: | 391 |
Sequence: | MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
|
|
|
BDBM50059090 |
---|
n/a |
---|
Name | BDBM50059090 |
Synonyms: | 10-(4-Amino-butyl)-19-(2-amino-3-phenyl-propionylamino)-16-benzyl-7-(1-hydroxy-ethyl)-13-(1H-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaaza-cycloicosane-4-carboxylic acid (2-hydroxy-1-hydroxymethyl-propyl)-amide | CHEMBL405598 | SMS 201-995 | octreotide |
Type | Small organic molecule |
Emp. Form. | C49H66N10O10S2 |
Mol. Mass. | 1019.239 |
SMILES | CC(O)[C@H](CO)NC(=O)[C@@H]1CSSCC(NC(=O)C(N)Cc2ccccc2)C(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H](CCCCN)C(=O)N[C@H](C(C)O)C(=O)N1 |
Structure |
|