Reaction Details |
| Report a problem with these data |
Target | Somatostatin receptor type 4 |
---|
Ligand | BDBM81767 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1.76±n/a nM |
---|
Comments | PDSP_1735 |
---|
Citation | Yang, L; Berk, SC; Rohrer, SP; Mosley, RT; Guo, L; Underwood, DJ; Arison, BH; Birzin, ET; Hayes, EC; Mitra, SW; Parmar, RM; Cheng, K; Wu, TJ; Butler, BS; Foor, F; Pasternak, A; Pan, Y; Silva, M; Freidinger, RM; Smith, RG; Chapman, K; Schaeffer, JM; Patchett, AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A95:10836-41 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Somatostatin receptor type 4 |
---|
Name: | Somatostatin receptor type 4 |
Synonyms: | SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SSR4_HUMAN | SST4R | SSTR4 | Somatostatin receptor type 4 (SSTR4) |
Type: | Enzyme |
Mol. Mass.: | 42015.38 |
Organism: | Homo sapiens (Human) |
Description: | P31391 |
Residue: | 388 |
Sequence: | MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
|
|
|
BDBM81767 |
---|
n/a |
---|
Name | BDBM81767 |
Synonyms: | 15-28-Somatostatin-28 | CAS_38916-34-6 | CB6417646 | Somatostatin-14 |
Type | Small organic molecule |
Emp. Form. | C76H104N18O19S2 |
Mol. Mass. | 1637.878 |
SMILES | C[C@@H](O)[C@@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@@H](C)O |r| |
Structure |
|