Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 5
LigandBDBM50064778
Substrate/Competitorn/a
Ki 2009±n/a nM
CommentsPDSP_7579
Citation Yang LBerk SCRohrer SPMosley RTGuo LUnderwood DJArison BHBirzin ETHayes ECMitra SWParmar RMCheng KWu TJButler BSFoor FPasternak APan YSilva MFreidinger RMSmith RGChapman KSchaeffer JMPatchett AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A 95:10836-41 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 5
Name:Somatostatin receptor type 5
Synonyms:SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | Somatostatin receptor type 5 (SSTR5)
Type:Enzyme
Mol. Mass.:39218.02
Organism:Homo sapiens (Human)
Description:P35346
Residue:364
Sequence:
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064778
n/a
NameBDBM50064778
Synonyms:(5S,8R,11R,14R,17R,19aR)-11-(4-Amino-butyl)-17-benzyl-5-(4-hydroxy-benzyl)-14-(1-hydroxy-ethyl)-8-(1H-indol-3-ylmethyl)-tetradecahydro-3a,6,9,12,15,18-hexaaza-cyclopentacyclooctadecene-4,7,10,13,16,19-hexaone | CHEMBL406471 | L-363,377 | L-363377
TypeSmall organic molecule
Emp. Form.C44H54N8O8
Mol. Mass.822.9484
SMILESCC(O)[C@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H]2CCCN2C(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](CCCCN)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: