Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 protease
LigandBDBM275775
Substrate/Competitorn/a
Meas. Tech.HSV-1 Antiviral Assay
EC50 3.00±n/a nM
Citation Hostetler KYBeadle JR Phosphonate compounds US Patent  US10071110 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
HIV-1 protease
Name:HIV-1 protease
Synonyms:n/a
Type:Protein
Mol. Mass.:10794.16
Organism:Human immunodeficiency virus
Description:Q9YQ34
Residue:99
Sequence:
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM275775
n/a
NameBDBM275775
Synonyms:US10071110, Compound 1-O-octadecylpropanediol-3-CDV
TypeSmall organic molecule
Emp. Form.C29H56N3O7P
Mol. Mass.589.7446
SMILESCCCCCCCCCCCCCCCCCCOCCCOP(O)(=O)COC(CO)Cn1ccc(N)nc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: