Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin 1C
LigandBDBM85383
Substrate/Competitorn/a
Ki 1380.38±n/a nM
CommentsPDSP_176
Citation Teh MTSugden D Comparison of the structure-activity relationships of melatonin receptor agonists and antagonists: lengthening the N-acyl side-chain has differing effects on potency on Xenopus melanophores. Naunyn Schmiedebergs Arch Pharmacol 358:522-8 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Melatonin 1C
Name:Melatonin 1C
Synonyms:Melatonin receptor 1C | Melatonin receptor type 1C
Type:Enzyme Catalytic Domain
Mol. Mass.:47442.40
Organism:Xenopus
Description:Melatonin 1C 0 Xenopus::P49219
Residue:420
Sequence:
MMEVNSTCLDCRTPGTIRTEQDAQDSASQGLTSALAVVLIFTIVVDVLGNILVILSVLRN
KKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSV
FNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTIIAIVPNFFVGSLQYDPRIF
SCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHRVRQDFKQKLTQTDLR
NFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIY
GVLNQNFRKEYKRILMSLLTPRLLFLDTSRGGTEGLKSKPSPAVTNNNQADMLGEARSLW
LSRRNGAKMVIIIRPRKAQIAIIHQIFWPQSSWATCRQDTKITGEEDGCRELCKDGISQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85383
n/a
NameBDBM85383
Synonyms:Luzindole,5-MeOT-N-hexanyl
Typen/a
Emp. Form.C24H30N2O2
Mol. Mass.378.5072
SMILESCCCCCC(=O)NCCc1c(Cc2ccccc2)[nH]c2ccc(OC)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: