Reaction Details |
| Report a problem with these data |
Target | Vasopressin V1a receptor |
---|
Ligand | BDBM35714 |
---|
Substrate/Competitor | n/a |
---|
Ki | 150±n/a nM |
---|
Comments | PDSP_1416 |
---|
Citation | Yamamura, Y; Nakamura, S; Itoh, S; Hirano, T; Onogawa, T; Yamashita, T; Yamada, Y; Tsujimae, K; Aoyama, M; Kotosai, K; Ogawa, H; Yamashita, H; Kondo, K; Tominaga, M; Tsujimoto, G; Mori, T OPC-41061, a highly potent human vasopressin V2-receptor antagonist: pharmacological profile and aquaretic effect by single and multiple oral dosing in rats. J Pharmacol Exp Ther287:860-7 (1998) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Vasopressin V1a receptor |
---|
Name: | Vasopressin V1a receptor |
Synonyms: | AVPR V1a | AVPR1 | AVPR1A | Antidiuretic hormone receptor 1a | V1AR_HUMAN | V1aR | VASOPRESSIN V1A | Vascular/hepatic-type arginine vasopressin receptor | Vasopressin V1 receptor | Vasopressin V1a receptor | Vasopressin receptor |
Type: | Receptor |
Mol. Mass.: | 46820.18 |
Organism: | Homo sapiens (Human) |
Description: | P37288 |
Residue: | 418 |
Sequence: | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
|
|
|
BDBM35714 |
---|
n/a |
---|
Name | BDBM35714 |
Synonyms: | CHEMBL420762 | Mozavaptan | N-[4-(5-Dimethylamino-2,3,4,5-tetrahydro-benzo[b]azepine-1-carbonyl)-phenyl]-2-methyl-benzamide | OPC-31260 |
Type | Small organic molecule |
Emp. Form. | C27H29N3O2 |
Mol. Mass. | 427.5381 |
SMILES | CN(C)C1CCCN(C(=O)c2ccc(NC(=O)c3ccccc3C)cc2)c2ccccc12 |
Structure |
|