Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalanin receptor 2
LigandBDBM85073
Substrate/Competitorn/a
Ki 1.07±n/a nM
CommentsPDSP_3166
Citation Borowsky BWalker MWHuang LYJones KASmith KEBard JBranchek TAGerald C Cloning and characterization of the human galanin GALR2 receptor. Peptides 19:1771-81 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Galanin receptor 2
Name:Galanin receptor 2
Synonyms:GALR2 | Galanin R2 | Galanin receptor 2 | Galanin receptor type 2 | Galanin receptor type 2 (GAL2-R) (GALR2).
Type:Enzyme Catalytic Domain
Mol. Mass.:41724.40
Organism:Homo sapiens (Human)
Description:Galanin R2 GALR2 HUMAN::O43603
Residue:387
Sequence:
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85073
n/a
NameBDBM85073
Synonyms:CAS_3043476 | Galantide (M15) | NSC_3043476
TypeSmall organic molecule
Emp. Form.C23H30N2O3
Mol. Mass.382.4959
SMILESCOc1ccccc1N(CCOc1ccc(C)cc1)C(=O)CN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: