Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR7
LigandBDBM10755
Substrate/Competitorn/a
Ki 0.10±n/a nM
CommentsPDSP_150
Citation Hemedah MCoupar IMMitchelson FJ [3H]-Mesulergine labels 5-HT7 sites in rat brain and guinea-pig ileum but not rat jejunum. Br J Pharmacol 126:179-88 (1999) [PubMed]  Article
More Info.:Get all data from this article
 
HTR7
Name:HTR7
Synonyms:5-HT7 | 5-HT7L | Serotonin 7 (5-HT7) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49632.36
Organism:GUINEA PIG
Description:5-HT7 HTR7 GUINEA PIG::P50407
Residue:446
Sequence:
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS
WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL
IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY
TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV
EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS
CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL
KLAERPERPECVLQNSDYCRKKGHDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: