Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM85392 |
---|
Substrate/Competitor | n/a |
---|
Ki | 7.3±n/a nM |
---|
Comments | PDSP_1519 |
---|
Citation | Ganapathy, ME; Prasad, PD; Huang, W; Seth, P; Leibach, FH; Ganapathy, V Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line. J Pharmacol Exp Ther289:251-60 (1999) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM85392 |
---|
n/a |
---|
Name | BDBM85392 |
Synonyms: | CAS_131443 | NSC_131443 | PPAP, (-) |
Type | Small organic molecule |
Emp. Form. | C18H23N |
Mol. Mass. | 253.3819 |
SMILES | CC(Cc1ccccc1)NCCCc1ccccc1 |
Structure |
|