Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycosylasparaginase (GA)
LigandBDBM85077
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH5.8±0
Temperature310.15±0 K
Ki 900000±0 nM
Citation Risley JMHuang DHKaylor JJMalik JJXia YQ Glycosylasparaginase inhibition studies: competitive inhibitors, transition state mimics, noncompetitive inhibitors. J Enzym Inhib 16:269-74 (2001) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glycosylasparaginase (GA)
Name:Glycosylasparaginase (GA)
Synonyms:N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
Type:Enzyme
Mol. Mass.:37206.38
Organism:Homo sapiens (Human)
Description:P20933
Residue:346
Sequence:
MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESG
CAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCG
PYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPI
PGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF
FGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85077
n/a
NameBDBM85077
Synonyms:3-Phosphono-D,L-2-aminopropionic acid, 7 | CAS_23052-80-4 | L-AP3 | NSC_3857
TypeSmall organic molecule
Emp. Form.C3H8NO5P
Mol. Mass.169.0731
SMILESNC(CP(O)(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: